Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardenswildflowerinsectsmeadowtropical
Bee from Cartoon animals coloring book
Lavender from Plants ii coloring book
American Redstart Birds and Honeycomb from Animals
Solidago or Goldenrod from Goldenrod
Dendrobium Nobile Orchid from Orchid
Chrysanthemum 3 from Perennial
Chrysanthemum 4 from Perennial
Golden Showers Climbing Rose from Roses
Charisma Yellow Red Floribunda Rose from Roses
Duchesse de Brabant Rose Bush from Roses
Bee from Cartoon animals viii coloring book
Black Raspberry from Celebrating wildflowers coloring book
Heliconia Indica from Heliconia
Spring Crocus from Crocus
Common Fruit Bats from Realistic animals coloring book
Cherokee Rose from Roses
Bug from Animals
Chinese Peony from Flowers
Butterfly from Cartoon animals vii coloring book
Hibiscus from Realistic flowers
Hibiscus Flower from Hawaii flower
Pollinators of Alaska from Nps
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Black Elderberry from Elderberry
Iris Motif from Iris
Orchid Lycaste Aromatica from Orchid
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Disa Kewensis Orchid from Orchid
Chrysanthemum 1 from Perennial
Iris Flower Blossom from Iris
Double Delight Hybrid Tea Rose from Roses
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Butterfly from Cartoon animals viii coloring book
Swallow Tail Hummingbird from Hummingbirds
Steampunk Bee from Steampunk animals coloring book
Bee from Cartoon animals v coloring book
Apple Blossom Branch from Apple tree
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Bumblebee from Woodland animals
Daffodil from Daffodil
Cosmos Scabiosoides from Cosmos
Realistic Sunflowers from Sunflower
Bumblebee from Simple objects coloring book
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals viii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Bumblebee
Ladybug from Cartoon animals v coloring book
Schlumbergera Bloom from Cactus
Aquilegia Truncata Red Columbine from Columbine
Viola Adunca or Pale Mountain Violet from Violet
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Cirsium Vulgare or Bull Thistle from Thistle
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Clarkia Amoena Farewell to Spring from Godetia
Oriental poppy from Perennial
Daffodil Flowers from Daffodil
Hummingbird from Cartoon animals ii coloring book
Saskatoon from Serviceberry
Renanthera Imschootiana Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Masdevallia Coccinea Orchid from Orchid
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Chrysanthemum Morifolium from Flower garden
Daffodil from Daffodil
Anemone Coronaria from Anemone
Yellow Edged Giant Owl Butterfly from Butterfly
Life Cycle of Monarch Butterfly from Biology
Big-Headed Clover from Celebrating wildflowers coloring book
Pink Hibiscus from Realistic flowers
Chrysanthemum Carinatum from Realistic flowers
Blooming Sunflower from Sunflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Scarlet Carnation from Carnation
Cornflower, Blue Bottle from Cornflowers
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Ranunculus Acris from Buttercup
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Heliconia Psittacorum from Heliconia
Burke's Larkspur from Celebrating wildflowers coloring book
Butterfly Flies On A Flower from Flowers
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper in Garden from Grasshoppers
Sundowner Rosa Grandiflora from Roses
Grasshopper on Flower from Grasshoppers
Sophronitis Cernua Orchid from Orchid
Aster 1 from Asters
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Cornflower from Cornflowers
Wildflower from Plants ii coloring book
201 - 300 of 1,830 Next page
/ 19